suzanne@enrichcreative.com
I thought about all the different sources of protein and which one I'd prefer to eat. They all sounded so good, but some of them were healthier than others. I decided to opt for the edamame. It would be challenging to get each kernel out of the pod, but in the end it would be well worth it. Delicious, healthy snacking, made convenient but with some work invested.
writing since 2016 · 2 entries · 2 days shown up
each square is a day—lit means Suzanne showed up.
1longest streak
2days written
2.8entries / week
the words Suzanne reaches for
deergracefulleaptbrushwoodsshelterstormblewyoungfawnswaitingskydarkerwindspickedsoon